Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HNF-3 beta/FoxA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$336.16 - $691.20
Specifications
| Antigen | HNF-3 beta/FoxA2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HNF-3 beta/FoxA2 Polyclonal specifically detects HNF-3 beta/FoxA2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| HNF-3 beta/FoxA2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B | |
| FOXA2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 3170 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title