Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP157121

hnRNP A1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157121 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157121 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157121 Supplier Novus Biologicals Supplier No. NBP157121
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

hnRNP A1 Polyclonal specifically detects hnRNP A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen hnRNP A1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6IPF2
Gene Alias Helix-destabilizing protein, heterogeneous nuclear ribonucleoprotein A1, heterogeneous nuclear ribonucleoprotein A1B protein, heterogeneous nuclear ribonucleoprotein B2 protein, heterogeneous nuclear ribonucleoprotein core protein A1, hnRNP A1, hnRNP core protein A1, hnRNPA1, hnRNP-A1, HNRPA1MGC102835, nuclear ribonucleoprotein particle A1 protein, single-strand DNA-binding protein UP1, Single-strand RNA-binding protein
Gene Symbols HNRNPA1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HNRPA1 (heterogeneous nuclear ribonucleoprotein A1) The peptide sequence was selected from the N terminal of HNRPA1. Peptide sequence MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3178
Test Specificity Expected identity based on immunogen sequence: Mouse: 100%; Equine: 100%; Sumatran orangutan: 100%; Crab-eating macaque: 100%; Rhesus macaque: 100%; Pig: 100%; Canine: 100%; Chicken: 100%; Bovine: 100%; Rat: 100%; Xenopus: 100%; Greater Equineshoe bat: 100%; Western clawed frog: 100%; Chimpanzee: 100%; Human: 100%; Atlantic salmon: 78%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.