hnRNP G Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179904

Catalog No. NBP179904

Description

hnRNP G Polyclonal specifically detects hnRNP G in Human samples. It is validated for Western Blot.

Specifications

• Antigen: hnRNP G
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Glycoprotein p43, heterogeneous nuclear ribonucleoprotein G, hnRNP G, hnRNP-G, HNRPG, RBMXP1, RBMXRT, RNA binding motif protein, X chromosome, RNA binding motif protein, X-linked, RNA-binding motif protein, X chromosome, RNMX
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_002130
• Gene Symbols: RBMX
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27316
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG