Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
hnRNP G Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | hnRNP G |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179904
|
Novus Biologicals
NBP179904 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP17990420
|
Novus Biologicals
NBP17990420UL |
20 μL | N/A | N/A | N/A | ||||
Description
hnRNP G Polyclonal specifically detects hnRNP G in Human samples. It is validated for Western Blot.Specifications
| hnRNP G | |
| Polyclonal | |
| Rabbit | |
| NP_002130 | |
| 27316 | |
| The specific Immunogen is proprietary information. Peptide sequence SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Glycoprotein p43, heterogeneous nuclear ribonucleoprotein G, hnRNP G, hnRNP-G, HNRPG, RBMXP1, RBMXRT, RNA binding motif protein, X chromosome, RNA binding motif protein, X-linked, RNA-binding motif protein, X chromosome, RNMX | |
| RBMX | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title