Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
hnRNP-R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | hnRNP-R |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157158
|
Novus Biologicals
NBP157158 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15715820
|
Novus Biologicals
NBP15715820UL |
20 μL | N/A | N/A | N/A | ||||
Description
hnRNP-R Polyclonal specifically detects hnRNP-R in Human samples. It is validated for Western Blot.Specifications
| hnRNP-R | |
| Polyclonal | |
| Rabbit | |
| O43390 | |
| 10236 | |
| Synthetic peptides corresponding to HNRNPR(heterogeneous nuclear ribonucleoprotein R) The peptide sequence was selected from the N terminal of HNRNPR. Peptide sequence ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ25714, heterogeneous nuclear ribonucleoprotein R, hnRNP R, HNRPRhnRNP-R | |
| HNRNPR | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title