HNRNPA0 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP157275	100 μL
NBP15727520	20 μL

Catalog No. NBP157275 Supplier Novus Biologicals Supplier No. NBP157275

Description

Rabbit Polyclonal Antibody

HNRNPA0 Polyclonal specifically detects HNRNPA0 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HNRNPA0
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 1 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q13151
• Gene Alias: heterogeneous nuclear ribonucleoprotein A0, hnRNA binding protein, hnRNPA0, HNRPA0hnRNP A0
• Gene Symbols: HNRNPA0
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to HNRPA0 (heterogeneous nuclear ribonucleoprotein A0) The peptide sequence was selected from the middle region of HNRPA0. Peptide sequence KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG.
• Purification Method: Protein A purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10949
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 92%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Pig, Bovine, Canine
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Form: Purified
• Isotype: IgG