HNRPDL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238017

Catalog No. NBP238017

Description

HNRPDL Polyclonal specifically detects HNRPDL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HNRPDL
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: O14979
• Gene Symbols: HNRPDL
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HVTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSA
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: A+U-rich element RNA binding factor, AU-rich element RNA-binding factor, heterogeneous nuclear ribonucleoprotein D-like, HNRNP, hnRNP DL, hnRNP D-like, JKTBP2, JKTBPJKT41-binding protein, laAUF1, Protein laAUF1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9987
• Target Species: Human
• Isotype: IgG