HNRPLL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157407

Catalog No. NBP157407

Description

HNRPLL Polyclonal specifically detects HNRPLL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HNRPLL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: heterogeneous nuclear ribonucleoprotein L-like, hnRNPLL, SRRF, stromal RNA regulating factor, Stromal RNA-regulating factor
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 92906
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WVV9
• Gene Symbols: HNRPLL
• Immunogen: Synthetic peptides corresponding to HNRPLL(heterogeneous nuclear ribonucleoprotein L-like) The peptide sequence was selected from the N terminal of HNRPLL. Peptide sequence MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Rabbit: 100%; Bovine: 92%; Rat: 91%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG