HOGA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214097

Catalog No. NBP214097

Description

HOGA1 Polyclonal specifically detects HOGA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HOGA1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 4-hydroxy-2-oxoglutarate aldolase 1, C10orf65, chromosome 10 open reading frame 65, DHDPS2, DHDPSLHP3, DHDPS-like protein, Dihydrodipicolinate synthase-like, dihydrodipicolinate synthase-like, mitochondrial, dihydrodipicolinate synthetase homolog 2, EC 4.1.3.16, FLJ37472, FLJ56960, N-acetylneuraminate pyruvate lyase 2 (putative), NPL2, Probable 2-keto-4-hydroxyglutarate aldolase, probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial, Probable KHG-aldolase, Protein 569272
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 112817
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: HOGA1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only