Homez Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180267

Catalog No. NBP180267

Description

Homez Polyclonal specifically detects Homez in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Homez
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: homeobox and leucine zipper encoding, homeobox and leucine zipper protein Homez, KIAA1443Homeodomain leucine zipper-containing factor
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57594
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_898997
• Gene Symbols: HOMEZ
• Immunogen: Synthetic peptide directed towards the N terminal of mouse HOMEZ. Peptide sequence LSPLAPSEQPTHMKGLKVEPEEPSQVSQLPLNHQNAKEPLMMGSRTFSHQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Rat: 84%.
• Target Species: Mouse, Rat
• Form: Purified