HOXA13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317383100UL

Catalog No. NB169841

Description

HOXA13 Polyclonal antibody specifically detects HOXA13 in Human samples. It is validated for Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: HOXA13
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin
• Gene Alias: homeo box 1J, homeo box A13, homeobox A13, Homeobox protein Hox-1J, homeobox protein HOXA13, HOX1, HOX1Jhomeobox protein Hox-A13, transcription factor HOXA13
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSY
• Quantity: 100 μg
• Research Discipline: Cell Biology
• Gene ID (Entrez): 3209
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified