Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HOXA13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

HOXA13 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB169842 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169842 25 μg
NB169841 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB169842 Supplier Novus Biologicals Supplier No. NBP31738325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

HOXA13 Polyclonal antibody specifically detects HOXA13 in Human samples. It is validated for Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen HOXA13
Applications Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias homeo box 1J, homeo box A13, homeobox A13, Homeobox protein Hox-1J, homeobox protein HOXA13, HOX1, HOX1Jhomeobox protein Hox-A13, transcription factor HOXA13
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSY
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 3209
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.