Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HOXB5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen HOXB5
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126712
View Documents
Novus Biologicals
NBP31090625UL
25 μg
Each for $106.19
Add to cart
 
NB126711
View Documents
Novus Biologicals
NBP310906100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

HOXB5 Polyclonal antibody specifically detects HOXB5 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

HOXB5
Western Blot, Immunohistochemistry
Purified
RUO
PBS buffer, 2% sucrose
3215
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Human
HHO.C10, homeo box 2A, homeo box B5, homeobox B5, Homeobox protein HHO.C10, Homeobox protein Hox-2A, homeobox protein Hox-B5, Homeobox protein Hu-1, Hox2.1, HOX2AHOX2, HU-1
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5 (NP_002138). Peptide sequence MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit