HOXC12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168929

Catalog No. NBP168929

Description

HOXC12 Polyclonal specifically detects HOXC12 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: HOXC12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HOC3F, homeo box 3F, homeo box C12, homeobox C12, Homeobox protein Hox-3F, homeobox protein Hox-C12, HOX3FHOX3
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8K5B8
• Gene Symbols: HOXC12
• Immunogen: Synthetic peptides corresponding to Hoxc12 (homeobox C12) The peptide sequence was selected from the N terminal of Hoxc12. Peptide sequence PLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3228
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG