Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HOXC12 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | HOXC12 |
|---|---|
| Immunogen | Synthetic peptides corresponding to Hoxc12 (homeobox C12) The peptide sequence was selected from the N terminal of Hoxc12. Peptide sequence PLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNG. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP16892920 |
Novus Biologicals
NBP16892920UL |
20ul |
Each for $149.00
|
|
NBP168929 |
Novus Biologicals
NBP168929 |
100 ul |
Each for $329.00
|
|
Description
HOXC12 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.Specifications
| HOXC12 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 3228 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptides corresponding to Hoxc12 (homeobox C12) The peptide sequence was selected from the N terminal of Hoxc12. Peptide sequence PLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLPWPSAEPCNG. | |
| Primary | |
| IgG | |
| HOC3F, homeo box 3F, homeo box C12, homeobox C12, Homeobox protein Hox-3F, homeobox protein Hox-C12, HOX3FHOX3 | |
| PBS & 2% Sucrose. with No Preservative | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title