Hrk Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15944720UL

Catalog No. NBP15944720

Description

Hrk Polyclonal specifically detects Hrk in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Hrk
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: O00198
• Gene Symbols: HRK
• Immunogen: Synthetic peptides corresponding to HRK(harakiri, BCL2 interacting protein (contains only BH3 domain)) The peptide sequence was selected from the N terminal of HRK. Peptide sequence MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: activator of apoptosis harakiri, activator of apoptosis Hrk, BCL2-interacting protein, BH3-interacting domain-containing protein 3, BID3, death protein 5, DP5, HARAKIRI, harakiri, BCL2 interacting protein (contains only BH3 domain), harakiri, BCL2-interacting protein (contains only BH3 domain), Neuronal death protein DP5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8739
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.