Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hrk Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | Hrk |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15944720
|
Novus Biologicals
NBP15944720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159447
|
Novus Biologicals
NBP159447 |
100 μL |
Each for $499.50
|
|
|||||
Description
Hrk Polyclonal specifically detects Hrk in Human samples. It is validated for Western Blot.Specifications
| Hrk | |
| Polyclonal | |
| Rabbit | |
| O00198 | |
| 8739 | |
| Synthetic peptides corresponding to HRK(harakiri, BCL2 interacting protein (contains only BH3 domain)) The peptide sequence was selected from the N terminal of HRK. Peptide sequence MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| activator of apoptosis harakiri, activator of apoptosis Hrk, BCL2-interacting protein, BH3-interacting domain-containing protein 3, BID3, death protein 5, DP5, HARAKIRI, harakiri, BCL2 interacting protein (contains only BH3 domain), harakiri, BCL2-interacting protein (contains only BH3 domain), Neuronal death protein DP5 | |
| HRK | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title