Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HS3ST3A1 Antibody, Novus Biologicals™
SDP

Catalog No. NB395566 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395566 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395566 Supplier Novus Biologicals Supplier No. NBP24966125UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

HS3ST3A1 Polyclonal antibody specifically detects HS3ST3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen HS3ST3A1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias 3-OST-3A, 3OST3A1heparan sulfate glucosamine 3-O-sulfotransferase 3A1,30ST3A1heparin-glucosamine 3-O-sulfotransferase, EC 2.8.2, EC 2.8.2.30, h3-OST-3A, heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1, Heparan sulfate 3-O-sulfotransferase 3A1, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, HS3ST3A
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Cytoskeleton Markers, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9955
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.