HSD17B3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23880725UL

Catalog No. NB396663

Description

HSD17B3 Polyclonal specifically detects HSD17B3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HSD17B3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P37058
• Gene Symbols: HSD17B3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NVGILPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLIL
• Quantity: 25 μL
• Research Discipline: Prostate Cancer
• Gene ID (Entrez): 3293
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 1.1.1.64, EDH17B317-beta-HSD3, hydroxysteroid (17-beta) dehydrogenase 3,17-beta-hydroxysteroid dehydrogenase type 3, SDR12C2, short chain dehydrogenase/reductase family 12C, member 2, Testicular 17-beta-hydroxysteroid dehydrogenase, testosterone 17-beta-dehydrogenase 3,17-beta-HSD 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.