Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSD17B3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | HSD17B3 |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
HSD17B3 Polyclonal specifically detects HSD17B3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
HSD17B3 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P37058 | |
3293 | |
This antibody was developed against a recombinant protein corresponding to amino acids: NVGILPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLIL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Prostate Cancer | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
EC 1.1.1.64, EDH17B317-beta-HSD3, hydroxysteroid (17-beta) dehydrogenase 3,17-beta-hydroxysteroid dehydrogenase type 3, SDR12C2, short chain dehydrogenase/reductase family 12C, member 2, Testicular 17-beta-hydroxysteroid dehydrogenase, testosterone 17-beta-dehydrogenase 3,17-beta-HSD 3 | |
HSD17B3 | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title