Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP156686

HSD17B6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156686 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156686 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156686 Supplier Novus Biologicals Supplier No. NBP156686
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

HSD17B6 Polyclonal specifically detects HSD17B6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen HSD17B6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O14756
Gene Alias 17-beta-HSD 6, 17-beta-HSD6, 17-beta-hydroxysteroid dehydrogenase type 6, 3(alpha->beta)-hydroxysteroid epimerase, 3-alpha->beta-HSE, EC 1.1.1, EC 1.1.1.105, EC 1.1.1.62, EC 1.1.1.63, HSE3-hydroxysteroid epimerase, hydroxysteroid (17-beta) dehydrogenase 6, hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse), NAD+ -dependent 3 alpha-hydroxysteroid dehydrogenase 3-hydroxysteroid epimerase, Oxidative 3-alpha hydroxysteroid dehydrogenase, oxidative 3-alpha-hydroxysteroid-dehydrogenase, oxidoreductase, retinol dehydrogenase, RODH3(alpha->beta)-hydroxysteroid epimerasel, SDR9C6, short chain dehydrogenase/reductase family 9C, member 6,3-alpha->beta-hydroxysteroid epimerase
Gene Symbols HSD17B6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HSD17B6(hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)) The peptide sequence was selected from the N terminal of HSD17B6 (NP_003716). Peptide sequence MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD.
Molecular Weight of Antigen 35 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8630
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.