Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HSD3B7 Antibody, Novus Biologicals™

HSD3B7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15699420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15699420 20 μL
NBP156994 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15699420 Supplier Novus Biologicals Supplier No. NBP15699420UL

Description

Rabbit Polyclonal Antibody

HSD3B7 Polyclonal specifically detects HSD3B7 in Human samples. It is validated for Western Blot.

Specifications

Antigen HSD3B7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H2F3
Gene Alias 3 beta-hydroxy-delta 5-C27-steroid oxidoreductase, 3 beta-hydroxysteroid dehydrogenase type 7, 3 beta-hydroxysteroid dehydrogenase type VII, 3-beta-HSD VII, 7-alpha-diol 3-beta-dehydrogenase, C(27) 3-beta-HSD, C(27)-3BETA-HSD, Cholest-5-ene-3-beta, EC 1.1.1.-, EC 1.1.1.181, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7,3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase, PFIC4, SDR11E3, short chain dehydrogenase/reductase family 11E, member 3
Gene Symbols HSD3B7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HSD3B7 (hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7) The peptide sequence was selected from the middle region of HSD3B7. Peptide sequence QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTK
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 80270
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.