HSDL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174267

Catalog No. NBP174267

Description

HSDL1 Polyclonal specifically detects HSDL1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HSDL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hydroxysteroid dehydrogenase like 1, inactive hydroxysteroid dehydrogenase-like protein 1, MGC125994, MGC125995, MGC126032, SDR12C3, short chain dehydrogenase/reductase family 12C, member 3, steroid dehydrogenase-like protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 83693
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q3SXM5
• Gene Symbols: HSDL1
• Immunogen: Synthetic peptides corresponding to the C terminal of HSDL1. Immunizing peptide sequence STLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: ; Rabbit: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG