Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HSDL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	HSDL1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17426720 View Documents View Product Certificates	Novus Biologicals NBP17426720UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP174267 View Documents View Product Certificates	Novus Biologicals NBP174267	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

HSDL1 Polyclonal specifically detects HSDL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	HSDL1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Lipid and Metabolism
Gene Alias	hydroxysteroid dehydrogenase like 1, inactive hydroxysteroid dehydrogenase-like protein 1, MGC125994, MGC125995, MGC126032, SDR12C3, short chain dehydrogenase/reductase family 12C, member 3, steroid dehydrogenase-like protein
Gene Symbols	HSDL1
Isotype	IgG
Molecular Weight of Antigen	37 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q3SXM5
Gene ID (Entrez)	83693
Immunogen	Synthetic peptides corresponding to the C terminal of HSDL1. Immunizing peptide sequence STLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

HSDL1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents