Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSDL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17426720UL
Description
HSDL1 Polyclonal specifically detects HSDL1 in Human samples. It is validated for Western Blot.Specifications
HSDL1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q3SXM5 | |
HSDL1 | |
Synthetic peptides corresponding to the C terminal of HSDL1. Immunizing peptide sequence STLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
hydroxysteroid dehydrogenase like 1, inactive hydroxysteroid dehydrogenase-like protein 1, MGC125994, MGC125995, MGC126032, SDR12C3, short chain dehydrogenase/reductase family 12C, member 3, steroid dehydrogenase-like protein | |
Rabbit | |
37 kDa | |
20 μL | |
Lipid and Metabolism | |
83693 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction