HSH2D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179862

Catalog No. NBP179862

Description

HSH2D Polyclonal specifically detects HSH2D in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HSH2D
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Adaptor in lymphocytes of unknown function X, ALXHematopoietic SH2 protein, FLJ14886, hematopoietic SH2 domain containing, hematopoietic SH2 domain-containing protein, HSH2
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 84941
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_116244
• Gene Symbols: HSH2D
• Immunogen: Synthetic peptide directed towards the C terminal of human HSH2DThe immunogen for this antibody is HSH2D. Peptide sequence DPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCIEVTPGDRSWHQMVVRA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Equine
• Isotype: IgG