Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSH2D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | HSH2D |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
HSH2D Polyclonal specifically detects HSH2D in Human samples. It is validated for Western Blot.Specifications
HSH2D | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
Adaptor in lymphocytes of unknown function X, ALXHematopoietic SH2 protein, FLJ14886, hematopoietic SH2 domain containing, hematopoietic SH2 domain-containing protein, HSH2 | |
HSH2D | |
IgG | |
39 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_116244 | |
84941 | |
Synthetic peptide directed towards the C terminal of human HSH2DThe immunogen for this antibody is HSH2D. Peptide sequence DPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCIEVTPGDRSWHQMVVRA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title