Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HSP10/EPF Antibody, Novus Biologicals™

HSP10/EPF Antibody, Novus Biologicals™
SDP

Catalog No. NB397268 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB397268 25 μL
NBP234055 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB397268 Supplier Novus Biologicals Supplier No. NBP23405525UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

HSP10/EPF Polyclonal specifically detects HSP10/EPF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen HSP10/EPF
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P61604
Gene Alias 10 kDa chaperonin, 10 kDa heat shock protein, mitochondrial, Chaperonin 10, CPN10HSP10, Early-pregnancy factor, EPF, GROES, heat shock 10kD protein 1 (chaperonin 10), heat shock 10kDa protein 1 (chaperonin 10), Hsp10
Gene Symbols HSPE1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Membrane Trafficking and Chaperones, Ovarian Carcinoma Cell Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3336
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.