Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSP10/EPF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$336.16 - $617.01
Specifications
| Antigen | HSP10/EPF |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
HSP10/EPF Polyclonal specifically detects HSP10/EPF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HSP10/EPF | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P61604 | |
| 3336 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Membrane Trafficking and Chaperones, Ovarian Carcinoma Cell Markers, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10 kDa chaperonin, 10 kDa heat shock protein, mitochondrial, Chaperonin 10, CPN10HSP10, Early-pregnancy factor, EPF, GROES, heat shock 10kD protein 1 (chaperonin 10), heat shock 10kDa protein 1 (chaperonin 10), Hsp10 | |
| HSPE1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title