HSP10/EPF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397268	Novus Biologicals NBP23405525UL	25 μL
NBP234055	Novus Biologicals NBP234055	0.1 mL

Description

HSP10/EPF Polyclonal specifically detects HSP10/EPF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HSP10/EPF
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P61604
• Gene ID (Entrez): 3336
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Core ESC Like Genes, Membrane Trafficking and Chaperones, Ovarian Carcinoma Cell Markers, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 10 kDa chaperonin, 10 kDa heat shock protein, mitochondrial, Chaperonin 10, CPN10HSP10, Early-pregnancy factor, EPF, GROES, heat shock 10kD protein 1 (chaperonin 10), heat shock 10kDa protein 1 (chaperonin 10), Hsp10
• Gene Symbols: HSPE1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only