Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSP10/EPF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP234055
Description
HSP10/EPF Polyclonal specifically detects HSP10/EPF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HSP10/EPF | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P61604 | |
| HSPE1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV | |
| 0.1 mL | |
| Core ESC Like Genes, Membrane Trafficking and Chaperones, Ovarian Carcinoma Cell Markers, Stem Cell Markers | |
| 3336 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10 kDa chaperonin, 10 kDa heat shock protein, mitochondrial, Chaperonin 10, CPN10HSP10, Early-pregnancy factor, EPF, GROES, heat shock 10kD protein 1 (chaperonin 10), heat shock 10kDa protein 1 (chaperonin 10), Hsp10 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction