Hsp70 interacting protein HIP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24878625UL

Catalog No. NB395991

Description

Hsp70 interacting protein HIP Polyclonal antibody specifically detects Hsp70 interacting protein HIP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Hsp70 interacting protein HIP
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Alias: AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEP
• Quantity: 25 μL
• Research Discipline: Membrane Trafficking and Chaperones
• Gene ID (Entrez): 6767
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified