HspB7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169072

Catalog No. NBP169072

Description

HspB7 Polyclonal specifically detects HspB7 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: HspB7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cardiovascular heat shock protein, CVHSP, DKFZp779D0968, FLJ32733, heat shock 27kDa protein family, member 7 (cardiovascular), heat shock protein beta-7, HspB7, member 7 (cardiovascular)
• Host Species: Rabbit
• Molecular Weight of Antigen: 19 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P35385
• Gene Symbols: HSPB7
• Immunogen: Synthetic peptides corresponding to Hspb7 (heat shock protein family, member 7 (cardiovascular)) The peptide sequence was selected from the middle region of Hspb7. Peptide sequence FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27129
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG