HspB7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16907220UL

Catalog No. NBP16907220

Description

HspB7 Polyclonal specifically detects HspB7 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: HspB7
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P35385
• Gene Symbols: HSPB7
• Immunogen: Synthetic peptides corresponding to Hspb7 (heat shock protein family, member 7 (cardiovascular)) The peptide sequence was selected from the middle region of Hspb7. Peptide sequence FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27129
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: Cardiovascular heat shock protein, CVHSP, DKFZp779D0968, FLJ32733, heat shock 27kDa protein family, member 7 (cardiovascular), heat shock protein beta-7, HspB7, member 7 (cardiovascular)
• Host Species: Rabbit
• Molecular Weight of Antigen: 19 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Mouse
• Isotype: IgG