Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HspB7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16907220UL
Description
HspB7 Polyclonal specifically detects HspB7 in Mouse samples. It is validated for Western Blot.Specifications
HspB7 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P35385 | |
HSPB7 | |
Synthetic peptides corresponding to Hspb7 (heat shock protein family, member 7 (cardiovascular)) The peptide sequence was selected from the middle region of Hspb7. Peptide sequence FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF. | |
Affinity Purified | |
RUO | |
27129 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
Cardiovascular heat shock protein, CVHSP, DKFZp779D0968, FLJ32733, heat shock 27kDa protein family, member 7 (cardiovascular), heat shock protein beta-7, HspB7, member 7 (cardiovascular) | |
Rabbit | |
19 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction