Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HspBAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | HspBAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180363
|
Novus Biologicals
NBP180363 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP18036320
|
Novus Biologicals
NBP18036320UL |
20 μL | N/A | N/A | N/A | ||||
Description
HspBAP1 Polyclonal specifically detects HspBAP1 in Human samples. It is validated for Western Blot.Specifications
| HspBAP1 | |
| Polyclonal | |
| Rabbit | |
| NP_078886 | |
| 79663 | |
| Synthetic peptide directed towards the N terminal of human HSPBAP1. Peptide sequence AAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ22623, heat shock 27 kDa associated protein, HSPB (heat shock 27kD) associated protein 1, HSPB (heat shock 27kDa) associated protein 1, HSPB1-associated protein 1,27 kDa heat shock protein-associated protein 1, PASS1FLJ39386, Protein associated with small stress protein 1, protein associating with small stress protein PASS1 | |
| HSPBAP1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title