Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HspBAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | HspBAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18036320
|
Novus Biologicals
NBP18036320UL |
20 μL |
Each for $152.22
|
|
NBP180363
|
Novus Biologicals
NBP180363 |
100 μL |
Each for $436.00
|
|
Description
HspBAP1 Polyclonal specifically detects HspBAP1 in Human samples. It is validated for Western Blot.Specifications
| HspBAP1 | |
| Polyclonal | |
| Rabbit | |
| NP_078886 | |
| 79663 | |
| Synthetic peptide directed towards the N terminal of human HSPBAP1. Peptide sequence AAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ22623, heat shock 27 kDa associated protein, HSPB (heat shock 27kD) associated protein 1, HSPB (heat shock 27kDa) associated protein 1, HSPB1-associated protein 1,27 kDa heat shock protein-associated protein 1, PASS1FLJ39386, Protein associated with small stress protein 1, protein associating with small stress protein PASS1 | |
| HSPBAP1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title