Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSU79274 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156675
Description
HSU79274 Polyclonal specifically detects HSU79274 in Human samples. It is validated for Western Blot.Specifications
| HSU79274 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Q8WUB2 | |
| FAM216A | |
| Synthetic peptides corresponding to C12ORF24 The peptide sequence was selected from the N terminal of C12ORF24. Peptide sequence AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ. | |
| 100 μL | |
| Stem Cell Markers | |
| 29902 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 12 open reading frame 24, HSU79274, hypothetical protein LOC29902, protein predicted by clone 23733 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Pig: 78%. | |
| Human, Porcine, Bovine | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title