Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HTRA2/Omi Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25889025UL
Description
HTRA2/Omi Polyclonal specifically detects HTRA2/Omi in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
HTRA2/Omi | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
High temperature requirement protein A2, HtrA serine peptidase 2, HtrA2, HtrA-like serine protease, OMIOmi stress-regulated endoprotease, PARK13EC 3.4.21.108, PRSS25serine, 25, Serine protease 25, serine protease HTRA2, mitochondrial, Serine proteinase OMI | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide | |
HTRA2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSP | |
25 μL | |
Apoptosis, Cancer, Mitochondrial Mediated Pathway | |
27429 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction