HTRA2/Omi Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258890

Catalog No. NBP258890

Description

HTRA2/Omi Polyclonal specifically detects HTRA2/Omi in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: HTRA2/Omi
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: High temperature requirement protein A2, HtrA serine peptidase 2, HtrA2, HtrA-like serine protease, OMIOmi stress-regulated endoprotease, PARK13EC 3.4.21.108, PRSS25serine, 25, Serine protease 25, serine protease HTRA2, mitochondrial, Serine proteinase OMI
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: HTRA2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSP
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer, Mitochondrial Mediated Pathway
• Gene ID (Entrez): 27429
• Target Species: Human
• Isotype: IgG

For Research Use Only