HUNK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438079	Novus Biologicals NBP21411025UL	25ul
NBP214110	Novus Biologicals NBP214110	0.1 mL

Description

HUNK Polyclonal specifically detects HUNK in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HUNK
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: B19, EC 2.7.11, EC 2.7.11.1, hormonally up-regulated neu tumor-associated kinase, hormonally upregulated neu tumor-associated kinase, hormonally up-regulated Neu-associated kinase, hormonally upregulated Neu-associated kinase, MAKV, serine/threonine protein kinase MAK-V, Serine/threonine-protein kinase MAK-V
• Gene Symbols: HUNK
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, GPCR, Protein Kinase
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 30811
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVRSFESVDR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only