HUS1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154582

Catalog No. NBP154582

Description

HUS1B Polyclonal specifically detects HUS1B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HUS1B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: checkpoint protein HUS1B, hHUS1B, HUS1 (S. pombe) checkpoint homolog b, HUS1 checkpoint homolog b (S. pombe), MGC126746, MGC126748, RP11-532F6.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 31 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NHY5
• Gene Symbols: HUS1B
• Immunogen: Synthetic peptides corresponding to HUS1B(HUS1 checkpoint homolog b (S. pombe)) The peptide sequence was selected from the N terminal of HUS1B. Peptide sequence ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 135458
• Target Species: Human
• Isotype: IgG