Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HUS1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15458220UL
Description
HUS1B Polyclonal specifically detects HUS1B in Human samples. It is validated for Western Blot.Specifications
HUS1B | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8NHY5 | |
HUS1B | |
Synthetic peptides corresponding to HUS1B(HUS1 checkpoint homolog b (S. pombe)) The peptide sequence was selected from the N terminal of HUS1B. Peptide sequence ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF. | |
Affinity Purified | |
RUO | |
135458 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
checkpoint protein HUS1B, hHUS1B, HUS1 (S. pombe) checkpoint homolog b, HUS1 checkpoint homolog b (S. pombe), MGC126746, MGC126748, RP11-532F6.1 | |
Rabbit | |
31 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction