Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HUS1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	HUS1B
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15458220 View Documents View Product Certificates	Novus Biologicals NBP15458220UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP154582 View Documents View Product Certificates	Novus Biologicals NBP154582	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

HUS1B Polyclonal specifically detects HUS1B in Human samples. It is validated for Western Blot.

Specifications

Antigen	HUS1B
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	checkpoint protein HUS1B, hHUS1B, HUS1 (S. pombe) checkpoint homolog b, HUS1 checkpoint homolog b (S. pombe), MGC126746, MGC126748, RP11-532F6.1
Gene Symbols	HUS1B
Isotype	IgG
Molecular Weight of Antigen	31 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q8NHY5
Gene ID (Entrez)	135458
Immunogen	Synthetic peptides corresponding to HUS1B(HUS1 checkpoint homolog b (S. pombe)) The peptide sequence was selected from the N terminal of HUS1B. Peptide sequence ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

HUS1B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents