Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™

Hydrogen Potassium ATPase Beta Antibody, Novus Biologicals™
SDP

Catalog No. NBP16002820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16002820 20 μL
NBP160028 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16002820 Supplier Novus Biologicals Supplier No. NBP16002820UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

Hydrogen Potassium ATPase Beta Polyclonal specifically detects Hydrogen Potassium ATPase Beta in Human samples. It is validated for Western Blot.

Specifications

Antigen Hydrogen Potassium ATPase Beta
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P51164
Gene Alias ATP6B, ATPase, H+/K+ exchanging, beta polypeptide, ATPase, H+/K+ transporting, beta polypeptide, Gastric H(+)/K(+) ATPase subunit beta, gastric H+/K+ ATPase beta subunit, gastric hydrogen-potassium ATPase, beta, potassium-transporting ATPase beta chain, potassium-transporting ATPase subunit beta, Proton pump beta chain
Gene Symbols ATP4B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK.
Molecular Weight of Antigen 33 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 496
Test Specificity This product is specific to Subunit or Isoform: beta.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.