HYPE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158290

Catalog No. NBP158290

Description

HYPE Polyclonal specifically detects HYPE in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: HYPE
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AMPylator FICD, EC 2.7.7.n1, FIC domain containing, FIC domain-containing protein, fic S-phase protein cell division homolog, HIP-13, HIP13UNQ3041, huntingtin interacting protein 13, Huntingtin interacting protein E, huntingtin interactor protein E, Huntingtin yeast partner E, Huntingtin-interacting protein 13, Huntingtin-interacting protein E, HYPEadenosine monophosphate-protein transferase FICD, MGC5623
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9BVA6
• Gene Symbols: FICD
• Immunogen: Synthetic peptides corresponding to FICD(FIC domain containing) The peptide sequence was selected from the C terminal of FICD. Peptide sequence GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 11153
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only