iASPP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23887925UL

Catalog No. NB436073

Description

iASPP Polyclonal specifically detects iASPP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: iASPP
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q8WUF5
• Gene Symbols: PPP1R13L
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDEL
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cancer, Caspases
• Gene ID (Entrez): 10848
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: IASPPinhibitor of apoptosis stimulating protein of p53, Inhibitor of ASPP protein, NFkB-interacting protein 1, NKIP1, PPP1R13BL, PPP1R13B-like protein, Protein iASPP, protein phosphatase 1, regulatory (inhibitor) subunit 13 like, protein phosphatase 1, regulatory subunit 13 like, RAINFkB interacting protein 1, relA-associated inhibitor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.