Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
iASPP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | iASPP |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
iASPP Polyclonal specifically detects iASPP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| iASPP | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q8WUF5 | |
| 10848 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: CNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDEL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Caspases | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| IASPPinhibitor of apoptosis stimulating protein of p53, Inhibitor of ASPP protein, NFkB-interacting protein 1, NKIP1, PPP1R13BL, PPP1R13B-like protein, Protein iASPP, protein phosphatase 1, regulatory (inhibitor) subunit 13 like, protein phosphatase 1, regulatory subunit 13 like, RAINFkB interacting protein 1, relA-associated inhibitor | |
| PPP1R13L | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title