Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
iASPP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238879
Description
iASPP Polyclonal specifically detects iASPP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
iASPP | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Q8WUF5 | |
PPP1R13L | |
This antibody was developed against a recombinant protein corresponding to amino acids: CNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDEL | |
0.1 mL | |
Apoptosis, Cancer, Caspases | |
10848 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
IASPPinhibitor of apoptosis stimulating protein of p53, Inhibitor of ASPP protein, NFkB-interacting protein 1, NKIP1, PPP1R13BL, PPP1R13B-like protein, Protein iASPP, protein phosphatase 1, regulatory (inhibitor) subunit 13 like, protein phosphatase 1, regulatory subunit 13 like, RAINFkB interacting protein 1, relA-associated inhibitor | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction