Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ICA1 Antibody, Novus Biologicals™

ICA1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15642620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15642620 20 μL
NBP156426 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15642620 Supplier Novus Biologicals Supplier No. NBP15642620UL

Description

Rabbit Polyclonal Antibody

ICA1 Polyclonal specifically detects ICA1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

Antigen ICA1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q05084
Gene Alias diabetes mellitus type I autoantigen, ICA69, ICAp69Islet cell autoantigen p69,69 kDa islet cell autoantigen, islet cell autoantigen 1, islet cell autoantigen 1 (69kD), islet cell autoantigen 1 isoform, islet cell autoantigen 1, 69kDa, p69
Gene Symbols ICA1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ICA1(islet cell autoantigen 1, 69kDa) The peptide sequence was selected from the N terminal of ICA1. Peptide sequence SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Diabetes Research, Growth and Development, Neuronal Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3382
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.