IDI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157587

Catalog No. NBP157587

Description

IDI1 Polyclonal specifically detects IDI1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IDI1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 5.3.3.2, IPP isomerase 1, IPP1, IPPI1, isopentenyl diphosphate dimethylallyl diphosphate isomerase 1, Isopentenyl pyrophosphate isomerase 1, isopentenyl-diphosphate delta isomerase, isopentenyl-diphosphate delta isomerase 1, isopentenyl-diphosphate Delta-isomerase 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Xenopus: 85%; Equine: 85%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q13907
• Gene Symbols: IDI1
• Immunogen: Synthetic peptides corresponding to IDI1(isopentenyl-diphosphate delta isomerase 1) The peptide sequence was selected from the middle region of IDI1. Peptide sequence PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA.
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 3422
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.