Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IER5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	IER5
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15480920 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15480920UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP154809 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP154809	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

IER5 Polyclonal specifically detects IER5 in Human samples. It is validated for Western Blot.

Specifications

Antigen	IER5
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q5VY09
Gene ID (Entrez)	51278
Immunogen	Synthetic peptides corresponding to IER5(immediate early response 5) The peptide sequence was selected from the N terminal of IER5. Peptide sequence MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	immediate early response 5, immediate early response gene 5 protein, MGC102760, SBBI48
Gene Symbols	IER5
Isotype	IgG
Molecular Weight of Antigen	34 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

IER5 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents